GYG2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GYG2 Polyclonal antibody (13150-1-AP)

GYG2 Polyclonal Antibody for WB, ELISA

Cat No. 13150-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.4.1.186, glycogenin 2, Glycogenin-2, GN 2, GN2

• 

  WB analysis of L02 using 13150-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 13150-1-AP (GYG2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 13150-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13150-1-AP (GYG2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 13150-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13150-1-AP (GYG2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GYG2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, HEK-293 cells, human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13150-1-AP targets GYG2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3765

  Product name: Recombinant human GYG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-471 aa of BC023152

  Sequence: FQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ

• Full Name: glycogenin 2
• Calculated Molecular Weight: 501 aa, 55 kDa
• Observed Molecular Weight: 45 kDa, 66-70 kDa
• GenBank Accession Number: BC023152
• Gene Symbol: GYG2
• Gene ID (NCBI): 8908
• RRID: AB_2116111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15488
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GYG2 belongs to the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation phase of glycogen biosynthesis. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, including the predominant band around 66 kDa and a light band around 45 kDa.

Publications

What published studies show

Antibody 13150-1-AP has 2 total citations, published in American Journal of Cancer Research (IF 3.1) and World Journal of Surgical Oncology (IF 2.8). The research fields cover breast cancer ferroptosis (glycogenin-2 targeting fatty acid oxidation regulation) and pancreatic cancer (ferroptosis-induced glycosylation remodeling of the immune microenvironment). The tested application was Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Am J Cancer Res; MCPB-21 targets glycogenin-2 to regulate fatty acid oxidation and promote ferroptosis of breast cancer.; Authors - Mengjie Mao
human	WB	World J Surg Oncol; Ferroptosis-induced remodeling of glycosylation the immune microenvironment and improves survival in pancreatic cancer.; Authors - Hao Tan