GYPB Polyclonal antibody

• 

GYPB Polyclonal Antibody for ELISA

Cat No. 18186-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

CD235b, Glycophorin B, GPB, GPB.NY, GYPB, GYPHe.NY, HGpMiVI, MNS, PAS 3, Sialoglycoprotein delta, SS, SS active sialoglycoprotein

---

Product Information

18186-1-AP targets GYPB in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12901

  Product name: Recombinant human GYPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC069310

  Sequence: MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA

• Full Name: glycophorin B (MNS blood group)
• Calculated Molecular Weight: 91 aa, 10 kDa
• GenBank Accession Number: BC069310
• Gene Symbol: GYPB
• Gene ID (NCBI): 2994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06028
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.