Galectin 10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Galectin 10 Polyclonal antibody (25225-1-AP)

Galectin 10 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25225-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CLC, Charcot Leyden crystal protein, Charcot-Leyden crystal protein, Gal 10, Gal-10

• 

  WB analysis of HL-60 using 25225-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25225-1-AP (Galectin 10 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 25225-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 25225-1-AP (Galectin 10 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 25225-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 25225-1-AP (Galectin 10 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 25225-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25225-1-AP (Galectin 10 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 25225-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25225-1-AP (Galectin 10 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of THP-1 using 25225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using Galectin 10 antibody (25225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of THP-1 using 25225-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using Galectin 10 antibody (25225-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells
• Positive IHC detected in: human lung tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25225-1-AP targets Galectin 10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18569

  Product name: Recombinant human CLC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC119711

  Sequence: MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

• Full Name: Charcot-Leyden crystal protein
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: BC119711
• Gene Symbol: Galectin 10
• Gene ID (NCBI): 1178
• RRID: AB_2879973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05315
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectin-10 (Gal-10), also called Charcot-Leyden Crystal (CLC) protein, is a member of the galectin superfamily of galactoside-binding lectins and is most prominently expressed in human eosinophils, where it forms the classic hexagonal bipyramidal Charcot-Leyden crystals that are considered hallmarks of eosinophilic inflammatory reactions.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cells; CUL4-DDB1-CRBN E3 Ubiquitin Ligase Regulates Proteostasis of ClC-2 Chloride Channels: Implication for Aldosteronism and Leukodystrophy.; Authors - Ssu-Ju Fu
human	IHC	Syst Biol Reprod Med; Identification of differentially expressed proteins associated with recurrence in ovarian endometriotic cysts.; Authors - Genhai Zhu
human	IHC	Int J Surg Pathol; Langerhans Cell Histiocytosis With Unusual Hexagonal Crystals in Addition to Usual Charcot-Leyden Crystals. Report of a Patient With Possible Process of Crystal Formation and Clinical Significance of a "Necrotic" Change; Authors - Sayaka Ando
		Oncol Lett; Construction of a new predictive model in head and neck squamous cell carcinoma based on the investigation of extracellular matrix-associated genes.; Authors - Liangqian Tu