Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Galectin-3 Recombinant monoclonal antibody

Galectin-3 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 82024-1-RR
Clone No.4M10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

35 kDa lectin, Carbohydrate-binding protein 35, CBP 35, CBP35, Gal 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, rat colon tissue, MCF-7 cells, A549 cells, A431 cells, NIH/3T3 cells, C6 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman thyroid cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82024-1-RR targets Galectin-3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6891

Product name: Recombinant human Galectin 3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-250 aa of BC001120

Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC001120
Gene Symbol Galectin-3
Gene ID (NCBI) 3958
RRIDAB_2935599
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17931
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).

Protocols

Product Specific Protocols
IF protocol for Galectin-3 antibody 82024-1-RRDownload protocol
IHC protocol for Galectin-3 antibody 82024-1-RRDownload protocol
IP protocol for Galectin-3 antibody 82024-1-RRDownload protocol
WB protocol for Galectin-3 antibody 82024-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

JCI Insight

HEY1-NCOA2 expression modulates chondrogenic differentiation and induces mesenchymal chondrosarcoma in mice

Authors - Miwa Tanaka
humanWB

Cell Signal

LAPTM5 confers cisplatin resistance in NSCLC by suppressing LAMP1 ubiquitination to stabilize lysosomal membranes and sustain autophagic flux

Authors - Fan Wu
humanIF

Bone Res

Chaperone-mediated autophagy directs a dual mechanism to balance premature senescence and senolysis to prevent intervertebral disc degeneration

Authors - Zhangrong Cheng
mouseWB,IHC,IF

Parasit Vectors

Galectin-receptor interaction: a key player in liver fibrosis induced by Schistosoma japonicum infection

Authors - Ziyun Huang
humanWB

Biomater Res

Versatile Nanotherapeutics for Enhancing Sonodynamic Therapy/Chemotherapy of Thyroid Cancer through Remodeling Tumor Microenvironment and Synergistic Reactive Oxygen Species Augment.

Authors - Dan Wang
humanWB

Clin Transl Med

Re-analysis of single-cell transcriptomics reveals a critical role of TNS1 gene in driving contractile VSMC transdifferentiation into macrophage-like SMC and atherosclerotic plaque instability.

Authors - Shuang Yang
Loading...
||
New chat

Able

正在加载,请稍候...