Anti-Mouse Galectin-3 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse Galectin-3 Rabbit Recombinant Antibody (98335-3-RR)

Galectin-3 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98335-3-RR Copied!

Clone No. 242453H5

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Gal-3, Lgals3, 242453H5, 35 kDa lectin

• 

  FC experiment of Balb/c mouse peritoneal macrophages using 98335-3-RR

  1x10^6 Balb/c mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse Galectin-3 Rabbit RecAb (98335-3-RR, Clone:242453H5) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Mouse CD11b. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Balb/c mouse peritoneal macrophages using 98335-3-RR

  1x10^6 Balb/c mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse Galectin-3 Rabbit RecAb (98335-3-RR, Clone:242453H5)(red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98335-3-RR

  Biolayer interferometry (BLl) kinetic assays of 98335-3-RR against Mouse Galectin-3 were performed. The affinity constant is 49.5 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Galectin-3 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: Balb/c mouse peritoneal macrophages

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98335-3-RR targets Galectin-3 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1232

  Product name: Recombinant Mouse Galectin-3 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 1-264 aa of

  Sequence: MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

• Full Name: lectin, galactose binding, soluble 3
• Calculated Molecular Weight: 28 kDa
• Gene Symbol: Lgals3
• Gene ID (NCBI): 16854
• RRID: AB_3745985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16110
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).