Galectin-4 Polyclonal antibody, PBS Only

• 

  WB analysis using 13391-1-AP (same clone as 13391-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 13391-1-AP (Galectin-4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13391-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 13391-1-AP (same clone as 13391-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13391-1-AP (Galectin-4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13391-1-AP (same clone as 13391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 13391-1-AP (Galectin-4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13391-1-AP (same clone as 13391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 13391-1-AP (Galectin-4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13391-1-PBS in a different storage buffer formulation.

• 

  IF Staining of COLO 320 using 13391-1-AP (same clone as 13391-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed COLO 320 cells using Galectin-4 antibody (13391-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13391-1-PBS in a different storage buffer formulation.

Galectin-4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13391-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13391-1-PBS targets Galectin-4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4049

  Product name: Recombinant human LGALS4,GAL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC034750

  Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

• Full Name: lectin, galactoside-binding, soluble, 4
• Calculated Molecular Weight: 323 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC034750
• Gene Symbol: Galectin-4
• Gene ID (NCBI): 3960
• RRID: AB_2137072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56470
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-4 contains two arbohydrate recognition domains (CRDs) and is expressed in the epithelium of oral mucosa, esophagus, and intestinal and colonic mucosa (PMID: 15546874; 15115909). Aberrant expression of galectin-4 has been reported in several cancers.