Galectin-7 Polyclonal antibody

• 

  WB analysis of mouse skin using 16730-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 16730-1-AP (Galectin-7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 16730-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 16730-1-AP (Galectin-7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervix using 16730-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervix using 16730-1-AP (Galectin-7 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human cervix using 16730-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervix using 16730-1-AP (Galectin-7 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of mouse skin using 16730-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 16730-1-AP (Galectin-7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 16730-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 16730-1-AP (Galectin-7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Galectin-7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16730-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

LGALS7B, Gal 7, GAL7, Gal-7, Galectin 7

---

Tested Applications

• Positive WB detected in: mouse skin tissue, mouse small intestine tissue
• Positive IHC detected in: human cervix tissue, mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16730-1-AP targets Galectin-7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10188

  Product name: Recombinant human Galectin-7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC073743

  Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

• Full Name: lectin, galactoside-binding, soluble, 7B
• Calculated Molecular Weight: 136 aa, 15 kDa
• Observed Molecular Weight: 14-15 kDa
• GenBank Accession Number: BC073743
• Gene Symbol: Galectin-7
• Gene ID (NCBI): 653499
• RRID: AB_10596781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-7 contains one carbohydrate recognition domain (CRD) and is biologically active as monomer. It is mainly expressed in stratified epithelium, especially in epidermis. Alterations of galectin-7 expression during cancer progression have been reported. Galectin-7 is involved in epithelial differentiation and development and may have a role in tumour development (PMID: 16429325).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		EJNMMI Res; Novel GAL7-targeted fluorescent molecular imaging probe for high-grade squamous intraepithelial lesion and cervical cancer screening; Authors - Xiaohui Teng