Galectin-7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Galectin-7 Polyclonal antibody (34369-1-AP)

• 

  WB analysis using 34369-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34369-1-AP (Galectin-7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat skin using 34369-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 34369-1-AP (Galectin-7 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 34369-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 34369-1-AP (Galectin-7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Galectin-7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 34369-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Gal-7, HKL-14, LGALS7, LGALS7B, p53-induced gene 1 protein

---

Tested Applications

• Positive WB detected in: mouse skin tissue, rat skin tissue
• Positive IHC detected in: rat skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34369-1-AP targets Galectin-7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg7637

  Product name: Recombinant human LGALS7 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 2-136 aa of NM_002307

  Sequence: SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

• Full Name: lectin, galactoside-binding, soluble, 7
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: NM_002307
• Gene Symbol: LGALS7
• Gene ID (NCBI): 3963
• RRID: AB_3743195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P47929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-7 contains one carbohydrate recognition domain (CRD) and is biologically active as a monomer. It is mainly expressed in stratified epithelium, especially in epidermis. Alterations of galectin-7 expression during cancer progression have been reported. Galectin-7 is involved in epithelial differentiation and development and may have a role in tumour development (PMID: 16429325).