Galectin-7 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Galectin-7 Recombinant monoclonal antibody, PBS Only (87943-1-PBS)

• 

  WB analysis using 87943-1-RR (same clone as 87943-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87943-1-RR (Galectin-7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87943-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat skin using 87943-1-RR (same clone as 87943-1-PBS)

  IP result of anti-Galectin-7 (IP:87943-1-RR, 4ug; Detection:87943-1-RR 1:2000) with rat skin tissue lysate 880 ug. This data was developed using the same antibody clone with 87943-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87943-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87943-1-RR against Human Galectin-7 were performed. The affinity constant is below 1 pM.

Galectin-7 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 87943-1-PBS

Clone No.260029G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Gal-7, HKL-14, LGALS7, LGALS7B, p53-induced gene 1 protein

---

Product Information

87943-1-PBS targets Galectin-7 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7637

  Product name: Recombinant human LGALS7 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 2-136 aa of NM_002307

  Sequence: SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

• Full Name: lectin, galactoside-binding, soluble, 7
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: NM_002307
• Gene Symbol: LGALS7
• Gene ID (NCBI): 3963
• RRID: AB_3745835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P47929
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-7 contains one carbohydrate recognition domain (CRD) and is biologically active as a monomer. It is mainly expressed in stratified epithelium, especially in epidermis. Alterations of galectin-7 expression during cancer progression have been reported. Galectin-7 is involved in epithelial differentiation and development and may have a role in tumour development (PMID: 16429325).