Gamma Tubulin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Gamma Tubulin Recombinant monoclonal antibody, PBS Only (87860-2-PBS)

Gamma Tubulin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87860-2-PBS

Clone No.253500C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

TUBG1, Gamma-1-tubulin, Gamma-tubulin complex component 1, GCP-1, TUBG

• 

  WB analysis using 87860-2-RR (same clone as 87860-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87860-2-RR (tubulin-gamma antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87860-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 87860-2-RR (same clone as 87860-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using tubulin-gamma antibody (87860-2-RR, Clone: 253500C11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87860-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87860-2-RR

  Biolayer interferometry (BLI) kinetic assays of 87860-2-RR against Human Gamma Tubulin were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87860-2-PBS targets Gamma Tubulin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7070

  Product name: Recombinant human tubulin-gamma protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 103-451 aa of BC000619

  Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

• Full Name: tubulin, gamma 1
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000619
• Gene Symbol: Gamma Tubulin
• Gene ID (NCBI): 7283
• RRID: AB_3745794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23258
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.