Glucagon Monoclonal antibody

Glucagon Monoclonal Antibody for IHC, IF-P, ELISA
Cat No. 67286-1-Ig
Clone No.2A8G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

GCG, 2A8G1, Glicentin-related polypeptide, Glucagon-like peptide 1, Glucagon-like peptide 1(7-36)

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman pancreas tissue, mouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue, human pancreas tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:2000-1:15000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67286-1-Ig targets Glucagon in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10629

Product name: Recombinant human Glucagon protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-180 aa of BC005278

Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Predict reactive species
Full Name glucagon
Calculated Molecular Weight 180 aa, 21 kDa
GenBank Accession NumberBC005278
Gene Symbol Glucagon
Gene ID (NCBI) 2641
RRIDAB_2882552
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucagon is a 29-amino acid peptide hormone secreted from the pancreatic alpha cells with a powerful stimulatory effect on hepatic glucose production acting to increase plasma glucose levels. Glucagon is best known as the counter-regulatory hormone to INS, and normal glucose homeostasis depends largely on the balanced secretion of INS and glucagon from the pancreatic beta and alpha cells, respectively.The regulation of glucose metabolism by glucagon is mediated by its direct action on the peripheral tissues such as the liver and also by the brain. Glucagon is also released postprandially in a transient manner, which was shown to be involved in inhibition of food intake via reduction of meal size.

Protocols

Product Specific Protocols
IHC protocol for Glucagon antibody 67286-1-IgDownload protocol
IF protocol for Glucagon antibody 67286-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Food Chem X

Dendrobium officinale leaf polysaccharides ameliorated hyperglycemia and promoted gut bacterial associated SCFAs to alleviate type 2 diabetes in adult mice.

Authors - Jingyu Fang
mouseIF

Life Sci Alliance

ciBAR1 loss in mice causes laterality defects, pancreatic degeneration, and altered glucose tolerance

Authors - Eunice N Kim
mouseIF

Mol Cell Endocrinol

Mof acetyltransferase inhibition ameliorates glucose intolerance and islet dysfunction of type 2 diabetes via targeting pancreatic α-cells.

Authors - Xinghong Guo
mouseIHC

Life Sci

Semaglutide alleviates the pancreatic β cell function via the METTL14 signaling and modulating gut microbiota in type 2 diabetes mellitus mice

Authors - Yunfei Luo
mouseIF

NPJ Biofilms Microbiomes

Bacteroides ovatus accelerates metformin-induced vitamin B12 deficiency in type 2 diabetes patients by accumulating cobalamin

Authors - Manyun Chen
human

Mol Metab

Long non-coding RNA LncCplx2 regulates glucose homeostasis and pancreatic β cell function

Authors - Linlin Wang
Loading...
||
New chat Able
正在加载,请稍候...