Glucagon Monoclonal antibody, PBS Only

Glucagon Monoclonal Antibody for IHC, IF-P, Indirect ELISA
Cat No. 67286-1-PBS
Clone No.2A8G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

GCG, 2A8G1, Glicentin-related polypeptide, Glucagon-like peptide 1, Glucagon-like peptide 1(7-36)

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67286-1-PBS targets Glucagon in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10629

Product name: Recombinant human Glucagon protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-180 aa of BC005278

Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Predict reactive species
Full Name glucagon
Calculated Molecular Weight 180 aa, 21 kDa
GenBank Accession NumberBC005278
Gene Symbol Glucagon
Gene ID (NCBI) 2641
RRIDAB_2882552
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01275
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Glucagon is a 29-amino acid peptide hormone secreted from the pancreatic alpha cells with a powerful stimulatory effect on hepatic glucose production acting to increase plasma glucose levels. Glucagon is best known as the counter-regulatory hormone to INS, and normal glucose homeostasis depends largely on the balanced secretion of INS and glucagon from the pancreatic beta and alpha cells, respectively.The regulation of glucose metabolism by glucagon is mediated by its direct action on the peripheral tissues such as the liver and also by the brain. Glucagon is also released postprandially in a transient manner, which was shown to be involved in inhibition of food intake via reduction of meal size.

Loading...
||
New chat Able
正在加载,请稍候...