Glutamine synthetase Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Glutamine synthetase Recombinant monoclonal antibody, PBS Only (86716-1-PBS)

Glutamine synthetase Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 86716-1-PBS

Clone No.251711A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

GLUL, EC:2.3.1.225, EC:6.3.1.2, GLNS, Glutamate--ammonia ligase

• 

  WB analysis using 86716-1-RR (same clone as 86716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86716-1-RR (Glutamine synthetase antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86716-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86716-1-RR (same clone as 86716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86716-1-RR (Glutamine synthetase antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86716-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 86716-1-RR (same clone as 86716-1-PBS)

  IP result of anti-Glutamine synthetase (IP:86716-1-RR, 4ug; Detection:86716-1-RR 1:2000) with mouse liver tissue lysate 2480 ug. This data was developed using the same antibody clone with 86716-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86716-1-PBS targets Glutamine synthetase in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1510

  Product name: Recombinant human Glutamine synthetase protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC011700

  Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

• Full Name: glutamate-ammonia ligase (glutamine synthetase)
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 40-42 kDa
• GenBank Accession Number: BC011700
• Gene Symbol: Glutamine Synthetase
• Gene ID (NCBI): 2752
• RRID: AB_3745075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15104
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts(PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137).