Glycerokinase Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Glycerokinase Recombinant monoclonal antibody (86604-3-RR)

• 

  WB analysis using 86604-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86604-3-RR (GK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86604-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86604-3-RR against Human Glycerokinase were performed. The affinity constant is 3.17 nM.

Glycerokinase Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86604-3-RR

Clone No.251506G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

GK, ATP:glycerol 3-phosphotransferase, EC:2.7.1.30, GK1, GKD

---

Tested Applications

• Positive WB detected in: HepG2 cells, rat kidney tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86604-3-RR targets Glycerokinase in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4175

  Product name: Recombinant human GK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC037549

  Sequence: MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYG

• Full Name: glycerol kinase
• Calculated Molecular Weight: 524 aa, 57 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC037549
• Gene Symbol: Glycerokinase
• Gene ID (NCBI): 2710
• RRID: AB_3745000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P32189
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycerokinase, also known as glycerol kinase (GK, EC 2.7.1.30), is a widely conserved phosphotransferase that catalyzes the ATP-dependent phosphorylation of glycerol to generate sn-glycerol-3-phosphate (G3P). Glycerokinase exists as four isoforms with apparent molecular masses of 61 kDa, 57 kDa, 61 kDa, and 58 kDa.