Glypican 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Glypican 2 Polyclonal antibody, PBS Only (13521-1-PBS)

• 

  WB analysis using 13521-1-AP (same clone as 13521-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13521-1-AP (Glypican 2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13521-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13521-1-AP (same clone as 13521-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13521-1-AP (Glypican 2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13521-1-PBS in a different storage buffer formulation.

Glypican 2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13521-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13521-1-PBS targets Glypican 2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4041

  Product name: Recombinant human GPC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC027972

  Sequence: MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQ

• Full Name: glypican 2
• Calculated Molecular Weight: 579 aa, 63 kDa
• Observed Molecular Weight: 62，70-100 kDa
• GenBank Accession Number: BC027972
• Gene Symbol: GPC2
• Gene ID (NCBI): 221914
• RRID: AB_3085417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N158
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glypican 2 (GPC2) is a heparan sulfate proteoglycan that is linked to the outer leaflet of the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage(PMID: 18505598). It is expected to be located in cell membrane and highly overexpressed in a high percentage of human neuroblastomas, medulloblastomas, and retinoblastomas. The calculated molecular weight of GPC2 is 62 kDa. And other bands are the result of glycosylation modification. Recent studies demonstrate that expression of the GPC2 protein is significantly increased in neuroblastoma and undetectable in normal tissues, including brain, heart, lung, and kidney, indicating that GPC2 is a suitable tumor antigen in neuroblastoma (PMID: 30352677).