Granzyme A Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of Jurkat using 84583-3-RR (same clone as 84583-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using GZMA antibody (84583-3-RR, Clone: 241979B8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84583-3-PBS in a different storage buffer formulation.

Granzyme A Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84583-3-PBS

Clone No.241979B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

GrA, GZMA, Fragmentin 1, EC:3.4.21.78, Cytotoxic T-lymphocyte proteinase 1

---

Product Information

84583-3-PBS targets Granzyme A in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1818

  Product name: Recombinant human GZMA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-262 aa of BC015739

  Sequence: MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

• Full Name: granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: BC015739
• Gene Symbol: Granzyme A
• Gene ID (NCBI): 3001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P12544
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Granzyme A(GrA, a tryptase) is necessary for target cell lysis in cell-mediated immune responses. It activates mitochondrial outer membrane permeabilization- and caspase-independent cell death pathways by cleaving the mitochondrial complex I component NDUFS3after lys56. Among serine proteases GrA has an unique quaternary structure consisting of a disulphide-linked homodimer of 60kDa linked via Cys93.(PMID: 12819769) This protein has 2 isoforms produced by alternative promoter usage with the MW of 29 and 27 kDa.