H1FX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• H1FX Polyclonal antibody, PBS Only (19321-1-PBS)

• 

  WB analysis using 19321-1-AP (same clone as 19321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19321-1-AP (H1FX antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19321-1-PBS in a different storage buffer formulation.

H1FX Polyclonal Antibody for WB, Indirect ELISA

Cat No. 19321-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Histone H1.10, Histone H1, Histone, H1X, H1-10

---

Product Information

19321-1-PBS targets H1FX in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5819

  Product name: Recombinant human H1FX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC000426

  Sequence: MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPK

• Full Name: H1 histone family, member X
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000426
• Gene Symbol: H1FX
• Gene ID (NCBI): 8971
• RRID: AB_3741959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92522
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

H1FX (Histone H1x) belongs to the histone H1/H5 family which plays a crucial role in the organization and regulation of chromatin structure.