H2AFY2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• H2AFY2 Polyclonal antibody (17030-1-AP)

H2AFY2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 17030-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

Core histone macro H2A.2, H2A histone family, member Y2, H2AFY2, histone, Histone macroH2A2, macroH2A2, mH2A2

• 

  WB analysis of HepG2 using 17030-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17030-1-AP (H2AFY2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 17030-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17030-1-AP (H2AFY2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 17030-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 17030-1-AP (H2AFY2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 17030-1-AP

  IP result of anti-H2AFY2 (IP:17030-1-AP, 4ug; Detection:17030-1-AP 1:500) with HepG2 cells lysate 1000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for H2AFY2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, human liver tissue, mouse kidney tissue
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17030-1-AP targets H2AFY2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10487

  Product name: Recombinant human Histone H2A.2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-372 aa of BC016172

  Sequence: MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK

• Full Name: H2A histone family, member Y2
• Calculated Molecular Weight: 372 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC016172
• Gene Symbol: H2AFY2
• Gene ID (NCBI): 55506
• RRID: AB_10638483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0M6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The H2AFY2 Polyclonal antibody (Cat# 17030-1-AP) has 5 total citations. These appear in Journal of Cellular Physiology (2), Archives of Biochemistry and Biophysics, Immunology and Cell Biology, and Cell Physiology and Biochemistry. All citations involve mouse WB studies focused on LPS-induced liver inflammation, NF-κB/SIRT1 signaling pathways, miRNA regulation, and protein deubiquitination—collectively spanning hepatology and inflammatory immunology.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Physiol; MCPIP1 regulates RORα expression to protect against liver injury induced by lipopolysaccharide via modulation of miR-155.; Authors - Zhenzhen Li
mouse	WB	J Cell Physiol; MCPIP1 alleviated lipopolysaccharide-induced liver injury by regulating SIRT1 via modulation of microRNA-9.; Authors - Shichao Han
mouse	WB	Arch Biochem Biophys; ROR alpha protects against LPS-induced inflammation by down-regulating SIRT1/NF-kappa B pathway.; Authors - Shichao Han
mouse	WB	Immunol Cell Biol; ING4 alleviated lipopolysaccharide-induced inflammation by regulating the NF-κB pathway via a direct interaction with SIRT1.; Authors - Yunshu Yang
mouse	WB	Cell Physiol Biochem; Klf4 Alleviates Lipopolysaccharide-Induced Inflammation by Inducing Expression of MCP-1 Induced Protein 1 to Deubiquitinate TRAF6.; Authors - Zhenzhen Li