• Featured Product
  • KD/KO Validated

Histone H3.3 Polyclonal antibody

Histone H3.3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 13754-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

H3F3A, HistoneH3.3, Histone H3, H3-3B, H3-3A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HeLa cells, HEK-293 cells, mouse thymus tissue, mouse kidney tissue, mouse lung tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13754-1-AP targets Histone H3.3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4696

Product name: Recombinant human Histone H3.3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-136 aa of BC038989

Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Predict reactive species
Full Name H3 histone, family 3A
Calculated Molecular Weight 136 aa, 15 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC038989
Gene Symbol Histone H3
Gene ID (NCBI) 3020
RRIDAB_2115140
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP84243
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Five classes of histone genes have been reported, some of which are expressed only during S phase, while others are replication independent. The latter are referred to as replacement histones and are expressed in quiescent or terminally differentiated cells. [PMID: 8586426] Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. H3F3A is one replacement histone [PMID:16258499].

Protocols

Product Specific Protocols
IF protocol for Histone H3.3 antibody 13754-1-APDownload protocol
IHC protocol for Histone H3.3 antibody 13754-1-APDownload protocol
WB protocol for Histone H3.3 antibody 13754-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Mol Sci

ADAM10 Plasma and CSF Levels Are Increased in Mild Alzheimer's Disease.

Authors - Izabela Pereira Vatanabe
humanWB

Biochem Biophys Res Commun

Protective effects of 4-octyl itaconate against inflammatory response in angiotensin II-induced oxidative stress in human primary retinal pigment epithelium.

Authors - Xinyu Fu

J Hepatol

IL-6/STAT3 axis dictates the PNPLA3-mediated susceptibility to non-alcoholic fatty liver disease

Authors - Jiwoon Park

Nat Genet

Symmetric inheritance of parental histones contributes to safeguarding the fate of mouse embryonic stem cells during differentiation

Authors - Qing Wen
ratIF

Fish Shellfish Immunol

Triclocarban evoked neutrophil extracellular trap formation in common carp (Cyprinus carpio L.) by modulating SIRT3-mediated ROS crosstalk with ERK1/2/p38 signaling

Authors - Siwen Li
humanWB

Life Sci

CP41, a novel curcumin analogue, induces apoptosis in endometrial cancer cells by activating the H3F3A/ proteasome-MAPK signaling pathway and enhancing oxidative stress

Authors - Min-Jie Zhang
Loading...
||
New chat Able
正在加载,请稍候...