HADHA Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87032-3-RR (same clone as 87032-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87032-3-RR (HADHA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87032-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 87032-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87032-3-RR against Human HADHA were performed. The affinity constant is below 1 pM.

HADHA Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87032-3-PBS

Clone No.252119B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

78 kDa gastrin binding protein, 78 kDa gastrin-binding protein, EC:2.3.1.-, ECHA, GBP

---

Product Information

87032-3-PBS targets HADHA in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1211

  Product name: Recombinant human HADHA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 339-763 aa of BC009235

  Sequence: LMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRGQQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ

• Full Name: hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 70-79 kDa
• GenBank Accession Number: BC009235
• Gene Symbol: HADHA
• Gene ID (NCBI): 3030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40939
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HADHA(Trifunctional enzyme subunit alpha, mitochondrial) is also named as HADH,78 kDa gastrin-binding protein.It belongs to the enoyl-CoA hydratase/isomerase family in the N-terminal section and the 3-hydroxyacyl-CoA dehydrogenase family in the central section.It harbors the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Defects in HADHA are a cause of trifunctional protein deficiency (TFP deficiency) and long-chain 3-hydroxyl-CoA dehydrogenase deficiency (LCHAD deficiency) and maternal acute fatty liver of pregnancy (AFLP).