HAGHL Polyclonal antibody

• 

  WB analysis using 15514-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15514-1-AP (HAGHL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HAGHL Polyclonal Antibody for WB, ELISA

Cat No. 15514-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Hydroxyacylglutathione hydrolase-like protein, EC:3.1.2.-

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15514-1-AP targets HAGHL in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7729

  Product name: Recombinant human HAGHL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-282 aa of BC004353

  Sequence: MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTVPSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAPHD

• Full Name: hydroxyacylglutathione hydrolase-like
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC004353
• Gene Symbol: HAGHL
• Gene ID (NCBI): 84264
• RRID: AB_3669210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PII5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HAGHL, or HAGHL gene, is a gene located on chromosome 16p13.3, and it encodes a protein that has been identified as a novel metabolic oncogene involved in the progression of human colorectal cancer (CRC). Recent studies have demonstrated that HAGHL plays a critical role in regulating CRC by influencing various metabolic pathways, which may contribute to tumor growth and development. (PMID: 36417085)