SPINT1/HAI-1 Monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 67031-1-Ig (same clone as 67031-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67031-1-Ig (HAI-1 antibody) at dilution of 1:900 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67031-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67031-1-Ig (same clone as 67031-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using HAI-1 antibody (67031-1-Ig, Clone: 2H2D8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67031-1-PBS in a different storage buffer formulation.

SPINT1/HAI-1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67031-1-PBS

Clone No.2H2D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HAI 1, HAI-1, SPINT1, 2H2D8, HAI

---

Product Information

67031-1-PBS targets SPINT1/HAI-1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26733

  Product name: Recombinant human SPINT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 307-441 aa of BC004140

  Sequence: SMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIP

• Full Name: serine peptidase inhibitor, Kunitz type 1
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC004140
• Gene Symbol: HAI-1
• Gene ID (NCBI): 6692
• RRID: AB_2882346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43278
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Hepatocyte growth factor activator inhibitor type 1 (HAI-1) is also named as SPINT1 and Kunitz-type protease inhibitor 1. HAI-1 is critical to control matriptase proteolytic activity (PMID: 25310042). HAI-1 inhibits matriptase activity through forming complex with activated matriptase (PMID: 30370662). matriptase, HAI‐1 also binds to and inhibits a variety of serine proteases including of hepsin, plasmin, prostasin, TMPRSS13 and HAT. HAI-1 as a cell-autonomous tumor suppressor that negatively regulates the HGF pathway (PMID: 25925948). HAI-1 is inhibitor of HGFAC (PMID: 9045658). HAI-1 inhibits serine protease activity of ST14/matriptase in vitro (PMID: 28710277). HAI-1 inhibits serine protease activity of TMPRSS13, via the BPTI/Kunitz inhibitor 1 domain (PMID: 20977675). HAI-1 expression is reduced in many cancer types, which is implicated in the progression of cancer and is associated with a worse prognosis in cancer patients (PMID: 30370662).