SPINT1/HAI-1 Monoclonal antibody, PBS Only

SPINT1/HAI-1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67031-1-PBS
Clone No.2H2D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

HAI 1, HAI-1, SPINT1, 2H2D8, HAI

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67031-1-PBS targets SPINT1/HAI-1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26733

Product name: Recombinant human SPINT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 307-441 aa of BC004140

Sequence: SMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIP

Predict reactive species
Full Name serine peptidase inhibitor, Kunitz type 1
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC004140
Gene Symbol HAI-1
Gene ID (NCBI) 6692
RRIDAB_2882346
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43278
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Hepatocyte growth factor activator inhibitor type 1 (HAI-1) is also named as SPINT1 and Kunitz-type protease inhibitor 1. HAI-1 is critical to control matriptase proteolytic activity (PMID: 25310042). HAI-1 inhibits matriptase activity through forming complex with activated matriptase (PMID: 30370662). matriptase, HAI‐1 also binds to and inhibits a variety of serine proteases including of hepsin, plasmin, prostasin, TMPRSS13 and HAT. HAI-1 as a cell-autonomous tumor suppressor that negatively regulates the HGF pathway (PMID: 25925948). HAI-1 is inhibitor of HGFAC (PMID: 9045658). HAI-1 inhibits serine protease activity of ST14/matriptase in vitro (PMID: 28710277). HAI-1 inhibits serine protease activity of TMPRSS13, via the BPTI/Kunitz inhibitor 1 domain (PMID: 20977675). HAI-1 expression is reduced in many cancer types, which is implicated in the progression of cancer and is associated with a worse prognosis in cancer patients (PMID: 30370662).

Loading...
||
New chat Able
正在加载,请稍候...