HAMP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HAMP Polyclonal antibody (26237-1-AP)

• 

  WB analysis using 26237-1-AP

  HepG2 cells lysate was subjected to SDS PAGE followed by western blot with 26237-1-AP (HAMP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 26237-1-AP

  IP result of anti-HAMP (IP:26237-1-AP, 4ug; Detection:26237-1-AP 1:500) with HepG2 cells lysate 1480 ug.

HAMP Polyclonal Antibody for WB, IP, ELISA

Cat No. 26237-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

HEPC, Hepc20, Hepc25 Hepcidin 20, HEPCIDIN, hepcidin antimicrobial peptide

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26237-1-AP targets HAMP in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24065

  Product name: Recombinant human HAMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-84 aa of BC020612

  Sequence: SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

• Full Name: hepcidin antimicrobial peptide
• Calculated Molecular Weight: 9 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC020612
• Gene Symbol: HAMP
• Gene ID (NCBI): 57817
• RRID: AB_3742176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P81172
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hepcidin (HAMP) is a liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. It acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PMID: 22682227; 29237594; 32814342). Hepcidin is an 84-amino acid prepropeptide, and is usually cleaved into three peptide types, hepcidin-20, hepcidin-22, and hepcidin-25, of which hepcidin-25 is the active form and plays important roles in regulating functional iron deficiency (PMID: 34262329).