Tested Applications
| Positive WB detected in | HepG2 cells |
| Positive IP detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26237-1-AP targets HAMP in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24065 Product name: Recombinant human HAMP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-84 aa of BC020612 Sequence: SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT Predict reactive species |
| Full Name | hepcidin antimicrobial peptide |
| Calculated Molecular Weight | 9 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC020612 |
| Gene Symbol | HAMP |
| Gene ID (NCBI) | 57817 |
| RRID | AB_3742176 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P81172 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Hepcidin (HAMP) is a liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. It acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PMID: 22682227; 29237594; 32814342). Hepcidin is an 84-amino acid prepropeptide, and is usually cleaved into three peptide types, hepcidin-20, hepcidin-22, and hepcidin-25, of which hepcidin-25 is the active form and plays important roles in regulating functional iron deficiency (PMID: 34262329).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for HAMP antibody 26237-1-AP | Download protocol |
| WB protocol for HAMP antibody 26237-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



