HAND1 Polyclonal antibody

• 

  WB analysis using 10882-1-AP

  SH-SY5Y (positive) and HeLa (negative) cells were subjected to SDS PAGE followed by western blot with 10882-1-AP (HAND1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HAND1 Polyclonal Antibody for WB, ELISA

Cat No. 10882-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

bHLHa27, Class A basic helix-loop-helix protein 27, eHAND, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1, Heart- and neural crest derivatives-expressed protein 1

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10882-1-AP targets HAND1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1324

  Product name: Recombinant human HAND1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC021190

  Sequence: MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ

• Full Name: heart and neural crest derivatives expressed 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC021190
• Gene Symbol: HAND1
• Gene ID (NCBI): 9421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The HAND1 gene encodes a basic helix-loop-helix (bHLH) transcription factor essential for mammalian heart development (PMID:19586923). HAND1 is highly expressed in the heart and in cytotrophoblastic cell lines, and is required in the adult for sustained expression of cardiac-specific genes (PMID:9931445).