Tested Applications
| Positive WB detected in | HeLa cells, SH-SY5Y cells, SK-N-SH cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21513-1-AP targets HAND2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16038 Product name: Recombinant human HAND2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC101406 Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYAS Predict reactive species |
| Full Name | heart and neural crest derivatives expressed 2 |
| Calculated Molecular Weight | 217 aa, 24 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC101406 |
| Gene Symbol | HAND2 |
| Gene ID (NCBI) | 9464 |
| RRID | AB_3742040 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HAND2 is a bHLH transcription factor essential for cardiac morphogenesis, neural crest differentiation, and limb development. Acting in the nucleus, it regulates gene networks shaping embryonic heart structure, craniofacial patterning, and limb polarity. Dysregulation of HAND2 is linked to congenital heart defects, craniofacial disorders, and certain cancers, highlighting its importance in both development and disease.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HAND2 antibody 21513-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

