HAP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HAP1 Polyclonal antibody, PBS Only (25133-1-PBS)

• 

  WB analysis of fetal human brain using 25133-1-AP (same clone as 25133-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 25133-1-AP (HAP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25133-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 25133-1-AP (same clone as 25133-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 25133-1-AP (HAP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25133-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 25133-1-AP (same clone as 25133-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25133-1-AP (HAP1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25133-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 25133-1-AP (same clone as 25133-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25133-1-AP (HAP1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25133-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 25133-1-AP (same clone as 25133-1-PBS)

  Immunofluorescent analysis of SH-SY5Y cells using 25133-1-AP (HAP1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25133-1-PBS in a different storage buffer formulation.

HAP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25133-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25133-1-PBS targets HAP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17705

  Product name: Recombinant human HAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 331-671 aa of BC156728

  Sequence: LREEASQLDTLEDEEQMLILECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQMQLQEESVWVGSQLQDLREKYMDCGGMLIEMQEEVKTLRQQPPVSTGSATHYPYSVPLETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEEGLMLAADIMRGEDFTPAEEFVPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELDEATRMNVVTSALEASGLGPSHLDMNYVLQQLANWQDAHYRRQLRWKMLQKGECPHGALPAASRTSCRSSCR

• Full Name: huntingtin-associated protein 1
• Calculated Molecular Weight: 671 aa, 76 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC156728
• Gene Symbol: HAP1
• Gene ID (NCBI): 9001
• RRID: AB_2879915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54257
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HAP1 (Huntingtin-associated protein 1) was originally identified as neuronal protein that specifically associates with HTT/huntingtin and the binding is enhanced by an expanded polyglutamine repeat within HTT. HTT is expressed ubiquitously, while HAP1 is expressed predominantly in the central nervous system (CNS). Both HTT and HAP1 participate in intracellular trafficking. HAP1 is involved in the vesicular transport, gene transcription regulation, membrane receptor trafficking and other functions such as calcium release and protein aggregation (PMID: 19262167).