HAPLN4 Polyclonal antibody

• 

  WB analysis of mouse brain using 21228-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21228-1-AP (HAPLN4 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 21228-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21228-1-AP (HAPLN4 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 21228-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21228-1-AP (HAPLN4 antibody) at dilution of 1:100 (under 40x lens).

HAPLN4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21228-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

Brain link protein 2, BRAL2, HAPLN4, KIAA1926

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

21228-1-AP targets HAPLN4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15687

  Product name: Recombinant human HAPLN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-206 aa of BC142644

  Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGL

• Full Name: hyaluronan and proteoglycan link protein 4
• Calculated Molecular Weight: 402 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC142644
• Gene Symbol: HAPLN4
• Gene ID (NCBI): 404037
• RRID: AB_10695504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UW8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Diabetes; Hepatokine ERAP1 Disturbs Skeletal Muscle Insulin Sensitivity via Inhibiting USP33-Mediated ADRB2 Deubiquitination.; Authors - Yuguo Niu
zebrafish	WB	bioRxiv; MMP-2/9 inhibition modulates sharp wave abundance, inhibitory proteoglycan sulfation, and fear memory in juvenile zebrafish: relevance to affective disorders; Authors - I Blanco