HARBI1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HARBI1 Polyclonal antibody, PBS Only (25946-1-PBS)

• 

  WB analysis using 25946-1-AP (same clone as 25946-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25946-1-AP (HARBI1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25946-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 25946-1-AP (same clone as 25946-1-PBS)

  WB result of HARBI1 antibody (25946-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HARBI1 transfected Jurkat cells. This data was developed using the same antibody clone with 25946-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HARBI1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25946-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

C11orf77, EC:3.1.-.-, Harbinger transposase-derived nuclease, Putative nuclease HARBI1

---

Product Information

25946-1-PBS targets HARBI1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22522

  Product name: Recombinant human HARBI1 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-349 aa of BC036925

  Sequence: MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS

• Full Name: harbinger transposase derived 1
• Calculated Molecular Weight: 349 aa, 39 kDa
• Observed Molecular Weight: ~39 kDa
• GenBank Accession Number: BC036925
• Gene Symbol: HARBI1
• Gene ID (NCBI): 283254
• RRID: AB_3669510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.