HARBI1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84482-4-RR (same clone as 84482-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84482-4-RR (HARBI1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84482-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84482-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84482-4-RR against Human HARBI1 were performed. The affinity constant is 78.4 pM.

HARBI1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84482-4-PBS

Clone No.241915C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Putative nuclease HARBI1, Harbinger transposase-derived nuclease, EC:3.1.-.-, C11orf77, 241915C10

---

Product Information

84482-4-PBS targets HARBI1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34137

  Product name: Recombinant human HARBI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC036925

  Sequence: MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS

• Full Name: harbinger transposase derived 1
• Calculated Molecular Weight: 349 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC036925
• Gene Symbol: HARBI1
• Gene ID (NCBI): 283254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96MB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HARBI1, also named as harbinger transposase derived 1, is predicted to enable metal ion binding activity and nuclease activity. HARBI1 is predicted to be involved in nucleic acid phosphodiester bond hydrolysis. [provided by Alliance of Genome Resources, Apr 2022] In plants, HARBI1 genes have developed new cellular functions to benefit the host, certain HARBI1 genes in rice and Arabidopsis thaliana ( A. thaliana) have been reported to play critical roles in regulating plant growth and development.(PMID:37950159)