HARS Recombinant monoclonal antibody, PBS Only (Capture)

HARS Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83497-1-PBS
Clone No.240495C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

240495C1, EC:6.1.1.21, HARS1, HisRS, Histidine--tRNA ligase, cytoplasmic

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83497-1-PBS targets HARS as part of a matched antibody pair:

MP00486-1: 83497-1-PBS capture and 83497-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9333

Product name: Recombinant human HARS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-282 aa of BC011807

Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQ

Predict reactive species
Full Name histidyl-tRNA synthetase
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC011807
Gene Symbol HARS
Gene ID (NCBI) 3035
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12081
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HARS is a cytoplasmic enzyme that belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. HARS is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis.

Loading...
||
New chat Able
正在加载,请稍候...