HAS2 Recombinant monoclonal antibody

• 

  WB analysis of HEK-293 using 83204-2-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 83204-2-RR (HAS2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83204-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83204-2-RR (HAS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 83204-2-RR

  WB result of HAS2 antibody (83204-2-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-HAS2 transfected HEK-293 cells.

• 

  Affinity and Kinetic Characterization of 83204-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83204-2-RR against Human HAS2 were performed. The affinity constant is 1.37 nM.

• Featured Product
• KD/KO Validated

HAS2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83204-2-RR

Clone No.240061G4

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, ELISA

Synonyms

Hyaluronic acid synthase 2, Hyaluronate synthase 2, hyaluronan synthase 2, HA synthase 2, EC:2.4.1.212

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HCT 116 cells, HT-29 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• IF: See 1 publications below

Product Information

83204-2-RR targets HAS2 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34945

  Product name: Recombinant human HAS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-170 aa of BC069353

  Sequence: EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQH

• Full Name: hyaluronan synthase 2
• Calculated Molecular Weight: 552 aa, 64 kDa
• Observed Molecular Weight: 63-67 kDa
• GenBank Accession Number: BC069353
• Gene Symbol: HAS2
• Gene ID (NCBI): 3037
• RRID: AB_3670892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92819
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIT2 (Hyaluronan synthase 2) is a member of the gene family encoding the hyaluronan synthase 2, which can generate high-molecular-weight hyaluronan (HMW-HA) (PMID: 35069543). HAS2 is the most critical synthase in producing hyaluronan and is well known for its involvement in cancer growth, metabolism and metastasis (PMID: 36386154). HAS2 is involved in cellular acquired resistance to drug therapy in BrCa. HAS2 expression was decreased in the endocrine-resistant ER+BrCa cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Gut Microbes; Helicobacter pylori activates histone lactylation to promote gastric cancer progression and immune evasion through the HAS2/c-MYC/PD-L1 axis.; Authors - Han Chen ; KD Validated