HAS3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HAS3 Polyclonal antibody, PBS Only (15609-1-PBS)

• 

  WB analysis using 15609-1-AP (same clone as 15609-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15609-1-AP (HAS3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 15609-1-AP (same clone as 15609-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 15609-1-AP (HAS3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 15609-1-AP (same clone as 15609-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15609-1-AP (HAS3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15609-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15609-1-AP (same clone as 15609-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15609-1-AP (HAS3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15609-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15609-1-AP (same clone as 15609-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15609-1-AP (HAS3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15609-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HAS3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15609-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15609-1-PBS targets HAS3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7999

  Product name: Recombinant human HAS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-281 aa of BC021853

  Sequence: MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

• Full Name: hyaluronan synthase 3
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC021853
• Gene Symbol: HAS3
• Gene ID (NCBI): 3038
• RRID: AB_2232886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00219
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HAS3(hyaluronan synthase 3) belongs to the NodC/HAS family, which are widely expressed in human tissues and appear to function in embryogenesis, wound healing and other processes associated with cellular proliferation and migration(PMID:14566823). HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. It may play a role in the progression of colon cancer and, as such, may provide novel targets for diagnostic and therapeutic interventions(PMID:14566823). It has 2 isoforms produced by alternative splicing and the protein has a glycosylation site.