HAT1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67971-1-Ig (same clone as 67971-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67971-1-Ig (HAT1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67971-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67971-1-Ig (same clone as 67971-1-PBS)

  WB result of HAT1 antibody (67971-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HAT1 transfected HEK-293 cells. This data was developed using the same antibody clone with 67971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 67971-1-Ig (same clone as 67971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 67971-1-Ig (HAT1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67971-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 67971-1-Ig (same clone as 67971-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human HAT1 (67971-1-Ig, Clone:1A11F6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67971-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HAT1 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 67971-1-PBS

Clone No.1A11F6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

1A11F6, EC:2.3.1.48, KAT1

---

Product Information

67971-1-PBS targets HAT1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1952

  Product name: Recombinant human HAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-419 aa of BC018682

  Sequence: MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

• Full Name: histone acetyltransferase 1
• Calculated Molecular Weight: 419 aa, 50 kDa
• Observed Molecular Weight: 45-46 kDa
• GenBank Accession Number: BC018682
• Gene Symbol: HAT1
• Gene ID (NCBI): 8520
• RRID: AB_2918721
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14929
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.