HBEGF Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

HBEGF Polyclonal Antibody for ELISA

Cat No. 17051-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Diphtheria toxin receptor, DT R, DTR, DTS, DTSF, HB EGF, HBEGF, HEGFL

---

Published Applications

• KD/KO: See 1 publications below

Product Information

17051-1-AP targets HBEGF in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10716

  Product name: Recombinant human HBEGF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-162 aa of BC033097

  Sequence: SLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTI

• Full Name: heparin-binding EGF-like growth factor
• Calculated Molecular Weight: 208 aa, 23 kDa
• GenBank Accession Number: BC033097
• Gene Symbol: HBEGF
• Gene ID (NCBI): 1839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Br J Cancer; Shed Syndecan-1 is involved in chemotherapy resistance via the EGFR pathway in colorectal cancer.; Authors - X Wang ; KD Validated