HBG1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HBG1 Recombinant monoclonal antibody, PBS Only (86851-1-PBS)

HBG1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86851-1-PBS

Clone No.251754H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Gamma 1 globin, Gamma-1-globin, Hb F Agamma, HBGA, HBGR

• 

  WB analysis using 86851-1-RR (same clone as 86851-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86851-1-RR (HBG1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86851-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of K-562 using 86851-1-RR (same clone as 86851-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using HBG1 antibody (86851-1-RR, Clone: 251754H5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86851-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86851-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86851-1-RR against Human HBG1 were performed. The affinity constant is 0.941 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86851-1-PBS targets HBG1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22776

  Product name: Recombinant human HBG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC010913

  Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH

• Full Name: hemoglobin, gamma A
• Calculated Molecular Weight: 147 aa, 16 kDa
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC010913
• Gene Symbol: HBG1
• Gene ID (NCBI): 3047
• RRID: AB_3745163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P69891
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HBG1, also named as Hb F Agamma, HBGA, HBGR and HSGGL, belongs to the globin family. HBG1 makes up the fetal hemoglobin F, in combination with alpha chains. Some gamma variants can cause severe jaundice and cyanosis in premature and new born babies. The antibody is specific to HBG1 and HBG2. The antibody has no cross reaction to HBB and HBD. HBG1 protein migrates around 16 kDa. Heterodimer of 32 kDa may also be observed. This antibody could identify HBG1 and HBG2.