HBG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HBG2 Polyclonal antibody, PBS Only (31753-1-PBS)

• 

  WB analysis using 31753-1-AP (same clone as 31753-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31753-1-AP (HBG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31753-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31753-1-AP (same clone as 31753-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31753-1-AP (HBG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31753-1-PBS in a different storage buffer formulation.

HBG2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31753-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31753-1-PBS targets HBG2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36028

  Product name: Recombinant human HBG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC029387

  Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLS

• Full Name: hemoglobin, gamma G
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 14~16 kDa
• GenBank Accession Number: BC029387
• Gene Symbol: HBG2
• Gene ID (NCBI): 3048
• RRID: AB_3670105
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P69892
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The gamma globin genes (HBG2, encoding Gγ-globin; HBG1 encoding Aγ-globin) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. Gamma chain production continues into adulthood in some beta-thalassemias and related conditions.