HBP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HBP1 Recombinant monoclonal antibody, PBS Only (87616-1-PBS)

• 

  WB analysis using 87616-1-RR (same clone as 87616-1-PBS)

  SGC-7901 cell lysates were subjected to SDS PAGE followed by western blot with 87616-1-RR (HBP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87616-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87616-1-RR (same clone as 87616-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87616-1-RR (HBP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87616-1-PBS in a different storage buffer formulation.

HBP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87616-1-PBS

Clone No.252869A10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

HMG box containing protein 1, HMG box transcription factor 1, HMG box-containing protein 1

---

Product Information

87616-1-PBS targets HBP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34576

  Product name: Recombinant human HBP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 215-514 aa of BC022329

  Sequence: FLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDPGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH

• Full Name: HMG-box transcription factor 1
• Calculated Molecular Weight: 514 aa, 58 kDa
• Observed Molecular Weight: 58-70 kDa
• GenBank Accession Number: BC022329
• Gene Symbol: HBP1
• Gene ID (NCBI): 26959
• RRID: AB_3745652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60381
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMG-box protein 1 (HBP1) is a transcriptional repressor, and has a role in cell cycle progression and tumor suppression. Also it's a repressor of the cyclin D1 gene and inhibits the Wnt signaling pathway. Interaction with RB1 enhances it's binding to the H1F0 promoter . Disrupts the interaction between DNA and TCF4.