HBQ1 Polyclonal antibody

• 

  WB analysis using 16706-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16706-1-AP (HBQ1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 16706-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16706-1-AP (HBQ1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human placenta using 16706-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16706-1-AP (HBQ1 antibody) at dilution of 1:200 (under 40x lens).

HBQ1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16706-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Theta 1 globin, hemoglobin, theta 1, Hemoglobin theta-1 chain, Hemoglobin theta 1 chain, Hemoglobin subunit theta-1

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16706-1-AP targets HBQ1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10105

  Product name: Recombinant human HBQ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC056686

  Sequence: MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

• Full Name: hemoglobin, theta 1
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 10~16 kDa
• GenBank Accession Number: BC056686
• Gene Symbol: HBQ1
• Gene ID (NCBI): 3049
• RRID: AB_1851212
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09105
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBQ1 (Hemoglobin subunit theta-1) is a member of the human alpha-globin gene cluster. HBQ1 mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue (PMID: 3657976). HBQ1 gene was transcribed in an erythroleukemia cell line. HBQ1 has transcriptionally active and may be expressed in early erythroid tissue (PMID: 3422341).