HBQ1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of K-562 using 83576-4-RR (same clone as 83576-4-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 83576-4-RR (HBQ1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83576-4-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 83576-4-RR (same clone as 83576-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using HBQ1 antibody (83576-4-RR, Clone: 240527D6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83576-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83576-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 83576-4-PBS against Human HBQ1 was performed. The affinity constant is below 1 pM.

• 

  Affinity and Kinetic Characterization of 83576-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83576-4-RR against Human HBQ1 were performed. The affinity constant is 73.4 pM.

HBQ1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 83576-4-PBS

Clone No.240527D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

240527D6, Hemoglobin subunit theta 1, Hemoglobin subunit theta-1, Hemoglobin theta 1 chain, Hemoglobin theta-1 chain

---

Product Information

83576-4-PBS targets HBQ1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10105

  Product name: Recombinant human HBQ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC056686

  Sequence: MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

• Full Name: hemoglobin, theta 1
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 10~16 kDa
• GenBank Accession Number: BC056686
• Gene Symbol: HBQ1
• Gene ID (NCBI): 3049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P09105
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HBQ1 (Hemoglobin subunit theta-1) is a member of the human alpha-globin gene cluster. HBQ1 mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue (PMID: 3657976). HBQ1 gene was transcribed in an erythroleukemia cell line. HBQ1 has transcriptionally active and may be expressed in early erythroid tissue (PMID: 3422341).