HBS1L Polyclonal antibody

• 

  WB analysis of Jurkat using 10359-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10359-1-AP (HBS1L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10359-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10359-1-AP (HBS1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10359-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10359-1-AP (HBS1L antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10359-1-AP

  WB result of HBS1L antibody (10359-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HBS1L transfected HEK-293 cells.

• 

  WB analysis of mouse brain using 10359-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10359-1-AP (HBS1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 10359-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 10359-1-AP (HBS1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 10359-1-AP

  IP result of anti-HBS1L (IP:10359-1-AP, 4ug; Detection:10359-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human pancreas cancer using 10359-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10359-1-AP (HBS1L antibody) at dilution of 1:50 (under 25x lens).

• 

  IF Staining of HepG2 using 10359-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HBS1L antibody (10359-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

HBS1L Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10359-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:3.6.5.-, EF 1a, ERFS, HBS 1, HBS1

---

Tested Applications

• Positive WB detected in: Jurkat cells, A2780 cells, HEK-293 cells, mouse brain tissue, SKOV-3 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 9 publications below
• IF: See 1 publications below

Product Information

10359-1-AP targets HBS1L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0388

  Product name: Recombinant human HBS1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-262 aa of BC001465

  Sequence: SRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLN

• Full Name: HBS1-like (S. cerevisiae)
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC001465
• Gene Symbol: HBS1L
• Gene ID (NCBI): 10767
• RRID: AB_2114730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y450
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBS1L (HBS1-like), also known as EF-1a or ERFS, is a 684 amino acid protein that belongs to the GTP-binding elongation factor family and exists as multiple alternatively spliced isoforms. Expressed in kidney, brain, heart, placenta, liver, muscle and pancreas, HSB1L is thought to play a role in controlling fetal hemoglobin levels, specifically influencing platelet, monocyte and erythrocyte hemoglobin content. The gene encoding HBS1L maps to a locus on human chromosome 6 that is associated with sickle cell anemia and beta-thalassemia, suggesting a role for HBS1L in the pathogenesis of blood disorders.This antibody specifically recognizes the 75kd human HBS1L protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Deep sequencing shows multiple oligouridylations are required for 3' to 5' degradation of histone mRNAs on polyribosomes.; Authors - Michael K Slevin
mouse	WB	Elife; Defects in translation-dependent quality control pathways lead to convergent molecular and neurodevelopmental pathology.; Authors - Markus Terrey
human	WB	Biochem J; Eukaryotic elongation factor 2 kinase regulates the cold stress response by slowing translation elongation.; Authors - John Rp Knight
human	WB	J Biol Chem; RNA exosome complex regulates stability of Hepatitis B Virus's X-mRNA transcript in a Non-Stop mediated (NSD) RNA quality control mechanism.; Authors - Hussein H Aly ; KD Validated
mouse	WB	PLoS Genet; Mammalian Hbs1L deficiency causes congenital anomalies and developmental delay associated with Pelota depletion and 80S monosome accumulation.; Authors - Amy E O'Connell ; KO Validated
mouse	WB	Immunity; Ribosome-rescuer PELO catalyzes the oligomeric assembly of NOD-like receptor family proteins via activating their ATPase enzymatic activity; Authors - Xiurong Wu ; KO Validated