HBZ Monoclonal antibody

• 

  WB analysis of K-562 using 67878-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67878-1-Ig (HBZ antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

HBZ Monoclonal Antibody for WB, ELISA

Cat No. 67878-1-Ig

Clone No.1F9C2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

1F9C2, HBAZ, HBZ2, Hemoglobin subunit zeta, Hemoglobin zeta chain

---

Tested Applications

• Positive WB detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67878-1-Ig targets HBZ in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11061

  Product name: Recombinant human HBZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC027892

  Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

• Full Name: hemoglobin, zeta
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC027892
• Gene Symbol: HBZ
• Gene ID (NCBI): 3050
• RRID: AB_2918635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02008
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBZ, also named as Zeta-globin and HBAZ, belongs to the globin family. HBZ is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac.