HBZ Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HBZ Recombinant monoclonal antibody (86879-3-RR)

• 

  WB analysis using 86879-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86879-3-RR (HBZ antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of K-562 using 86879-3-RR

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using HBZ antibody (86879-3-RR, Clone: 251873A7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86879-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86879-3-RR against Human HBZ were performed. The affinity constant is below 1 pM.

HBZ Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86879-3-RR

Clone No.251873A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

HBAZ, HBZ2, Hemoglobin subunit zeta, Hemoglobin zeta chain, hemoglobin, mu

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86879-3-RR targets HBZ in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11061

  Product name: Recombinant human HBZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC027892

  Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

• Full Name: hemoglobin, zeta
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC027892
• Gene Symbol: HBZ
• Gene ID (NCBI): 3050
• RRID: AB_3745181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02008
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBZ, also named as Zeta-globin and HBAZ, belongs to the globin family. HBZ is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. HBZ was first identified as an antisense viral protein that associated with cAMP-response element binding protein-2 (CREB-2) in HTLV-1-infected cells. HBZ is the only viral gene that is expressed in all ATL cases (PMID: 22787458). ShRNA repression of HBZ expression in established HTLV-1-transformed cell lines and newly immortalized T-lymphocytes also significantly suppressed T-lymphocyte proliferation (PMID: 19650892, 16917009).