HCLS1 Polyclonal antibody

• 

  WB analysis of Jurkat using 25003-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25003-1-AP (HCLS1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 25003-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25003-1-AP (HCLS1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human tonsillitis using 25003-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25003-1-AP (HCLS1 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HCLS1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25003-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

p75, LckBP1, HS1, Hematopoietic lineage cell-specific protein, Hematopoietic cell-specific LYN substrate 1

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below

Product Information

25003-1-AP targets HCLS1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8645

  Product name: Recombinant human HCLS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 142-486 aa of BC016758

  Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

• Full Name: hematopoietic cell-specific Lyn substrate 1
• Calculated Molecular Weight: 486 aa, 54 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC016758
• Gene Symbol: HCLS1
• Gene ID (NCBI): 3059
• RRID: AB_2879842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14317
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; Transcriptome-Based Network Analysis Unveils Eight Immune-Related Genes as Molecular Signatures in the Immunomodulatory Subtype of Triple-Negative Breast Cancer.; Authors - Jinguo Zhang
canine	WB	Vaccines (Basel); Transcriptional Analysis of lncRNA and Target Genes Induced by Influenza A Virus Infection in MDCK Cells; Authors - Geng Liu
human	WB,IHC	Clin Cosmet Investig Dermatol; Identification of a Gene Expression Signature to Predict the Risk of Abdominal Aortic Aneurysm in Psoriasis Patients; Authors - Xintong Lyu