HCRTR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HCRTR2 Polyclonal antibody, PBS Only (32859-1-PBS)

• 

  WB analysis using 32859-1-AP (same clone as 32859-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32859-1-AP (HCRTR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32859-1-PBS in a different storage buffer formulation.

HCRTR2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32859-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Hypocretin receptor type 2, Orexin receptor type 2, Ox2R, Ox-2-R, Ox2-R

---

Product Information

32859-1-PBS targets HCRTR2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38128

  Product name: Recombinant human HCRTR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 380-444 aa of NM_001526

  Sequence: SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW

• Full Name: hypocretin (orexin) receptor 2
• Calculated Molecular Weight: 440aa, 51 kDa
• Observed Molecular Weight: 70-73 kDa
• GenBank Accession Number: NM_001526
• Gene Symbol: HCRTR2
• Gene ID (NCBI): 3062
• RRID: AB_3742766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43614
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.