Product Information
32859-1-PBS targets HCRTR2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38128 Product name: Recombinant human HCRTR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 380-444 aa of NM_001526 Sequence: SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW Predict reactive species |
| Full Name | hypocretin (orexin) receptor 2 |
| Calculated Molecular Weight | 440aa, 51 kDa |
| Observed Molecular Weight | 70-73 kDa |
| GenBank Accession Number | NM_001526 |
| Gene Symbol | HCRTR2 |
| Gene ID (NCBI) | 3062 |
| RRID | AB_3742766 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O43614 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
HCRTR2 encodes hypocretin receptor 2, a G protein-coupled receptor that binds the neuropeptides orexin-A and orexin-B with high affinity. Through this binding, it activates G(q)/11 and G(i)/o signaling to modulate cytoplasmic Ca2+ levels and neuronal excitability, placing it at the center of sleep-wake cycle regulation and central glucose homeostasis. Protein expression is high in the brain, consistent with its role in neural control of arousal and metabolism.

