HDAC1 Recombinant monoclonal antibody, PBS Only (Capture)

HDAC1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83624-2-PBS
Clone No.240614A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

histone deacetylase 1, HD1, GON 10, EC:3.5.1.98, EC:3.5.1.-

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83624-2-PBS targets HDAC1 as part of a matched antibody pair:

MP00577-1: 83624-2-PBS capture and 83624-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0256

Product name: Recombinant human HDAC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 184-482 aa of BC000301

Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Predict reactive species
Full Name histone deacetylase 1
Calculated Molecular Weight 55 kDa
GenBank Accession NumberBC000301
Gene Symbol HDAC1
Gene ID (NCBI) 3065
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13547
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...