Filter: AllIHCIF/ICC

IHC staining of human testis using 23328-1-AP (same clone as 23328-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23328-1-AP (HDAC9 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 23328-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 23328-1-AP (same clone as 23328-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23328-1-AP (HDAC9 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 23328-1-PBS in a different storage buffer formulation.
IF Staining of SH-SY5Y using 23328-1-AP (same clone as 23328-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using HDAC9 antibody (23328-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 23328-1-PBS in a different storage buffer formulation.

HDAC9 Polyclonal antibody, PBS Only

Name: HDAC9 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 23328-1-PBS

HDAC9 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 23328-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

23328-1-PBS targets HDAC9 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19930 Product name: Recombinant human HDAC9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 477-590 aa of BC152405 Sequence: QYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII Predict reactive species
Full Name	histone deacetylase 9
Calculated Molecular Weight	1011 aa, 111 kDa
Observed Molecular Weight	100 kDa
GenBank Accession Number	BC152405
Gene Symbol	HDAC9
Gene ID (NCBI)	9734
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	Q9UKV0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™