HDGFL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HDGFL1 Polyclonal antibody (31923-1-AP)

• 

  WB analysis using 31923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31923-1-AP (HDGFL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

HDGFL1 Polyclonal Antibody for WB, ELISA

Cat No. 31923-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HDGF (Hepatoma-Derived Growth Factor) Like , HDGF Like 1 , Hdgfrp1, Hepatoma-derived growth factor-like protein 1, HRP-1

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31923-1-AP targets HDGFL1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36944

  Product name: Recombinant human HDGFL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-251 aa of NM_138574

  Sequence: GSGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEEEKGPLKRSAGDPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVAVENGSAPSEPGLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDSL

• Full Name: hepatoma derived growth factor-like 1
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_138574
• Gene Symbol: HDGFL1
• Gene ID (NCBI): 154150
• RRID: AB_3670147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TGJ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hepatoma-derived growth factor-like 1 (HDGFL1, also known as HRP-1, PWWP1, and Hdgfrp1) is a member of the hepatoma-derived growth factor (HDGF) family related to tumorigenesis and the development of cancer (PMID: 18823380;  20509080). It is specifically expressed in the testis and activated in the nucleus (PMID: 22217008).