HDLBP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HDLBP Polyclonal antibody (15406-1-AP)

• Featured Product
• KD/KO Validated

HDLBP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15406-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

Synonyms

Vigilin, VGL, PRO2900, High density lipoprotein-binding protein, HDL-binding protein

• 

  WB analysis using 15406-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15406-1-AP (HDLBP antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 15406-1-AP

  IP result of anti-HDLBP (IP:15406-1-AP, 4ug; Detection:15406-1-AP 1:500) with Jurkat cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 15406-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 15406-1-AP (HDLBP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 15406-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 15406-1-AP (HDLBP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 15406-1-AP

  Immunofluorescent analysis of MCF-7 cells, using HDLBP antibody 15406-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HDLBP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15406-1-AP targets HDLBP in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7666

  Product name: Recombinant human HDLBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 909-1268 aa of BC001179

  Sequence: FPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR

• Full Name: high density lipoprotein binding protein
• Calculated Molecular Weight: 141 kDa
• Observed Molecular Weight: 141 kDa
• GenBank Accession Number: BC001179
• Gene Symbol: HDLBP
• Gene ID (NCBI): 3069
• RRID: AB_2117367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00341
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HDLBP Polyclonal antibody (Cat# 15406-1-AP) has 5 total citations published in Advanced Science, Cell Molecular Gastroenterology and Hepatology, Journal of Medical Virology, Experimental Cell Research, and Molecular Carcinogenesis. The associated research fields include hepatocellular carcinoma and sorafenib resistance, small cell lung cancer biomarker discovery, ferritinophagy and lipid metabolism in viral replication (PRRSV/IAV), hepatitis B-related apoptosis, and TGF-β/Smad signaling in liver cancer.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Adv Sci (Weinh); Ferritinophagy Rewires Carnitine-Dependent Lipid Metabolism to Inhibit PRRSV and IAV Replication.; Authors - Kaifeng Guan
human	WB,IHC,IF,CoIP	Cell Mol Gastroenterol Hepatol; HDLBP promotes hepatocellular carcinoma proliferation and sorafenib resistance by suppressing Trim71-dependent RAF1 degradation; Authors - Jingsheng Yuan
human	WB	J Med Virol; Proteomic analysis of cell lines expressing small hepatitis B surface antigen revealed decreased glucose-regulated protein 78 kDa expression in association with higher susceptibility to apoptosis.; Authors - Zhao Chao C
human	RIP,IF	Mol Carcinog; MFSD2A Overexpression Inhibits Hepatocellular Carcinoma Through TGF-β/Smad Signaling; Authors - Chaowen Xiao
human	WB,IHC	Exp Cell Res; A new small cell lung cancer biomarker identified by Cell-SELEX generated aptamers.; Authors - Wei Zhou ; KD Validated