HEATR2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HEATR2 Recombinant monoclonal antibody (87423-1-RR)

• 

  WB analysis of HEK-293 using 87423-1-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 87423-1-RR (HEATR2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87423-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87423-1-RR against Human HEATR2 were performed. The affinity constant is 1.44 nM.

HEATR2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87423-1-RR

Clone No.252814E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DNAAF5, Dynein axonemal assembly factor 5, HEAT repeat containing 2, HEAT repeat-containing protein 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87423-1-RR targets HEATR2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20080

  Product name: Recombinant human HEATR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 661-809 aa of BC047240

  Sequence: NLQWHAGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIRIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAI

• Full Name: HEAT repeat containing 2
• Calculated Molecular Weight: 855 aa, 94 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC047240
• Gene Symbol: HEATR2
• Gene ID (NCBI): 54919
• RRID: AB_3745535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86Y56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HEATR2 also termed as HEAT repeat containing 2 is an 855 amino acid protein. HEATR2 is a member of a family of ten other uncharacterized HEAT-repeat-containing proteins, which contains HEAT (Huntingtin, elongation factor 3 (EF3), protein phosphatase 2A (PP2A) and the yeast PI3-kinase Tor1) repeats. HEAT repeats form rod-like helical structures that are involved in intracellular transport. HEATR2 play an important role in dynein arm transportation or assembly. HEATR2 mutation is implicated in Primary ciliary dyskinesia 18.