HEATR3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HEATR3 Polyclonal antibody, PBS Only (27335-1-PBS)

• 

  WB analysis of HEK-293 using 27335-1-AP (same clone as 27335-1-PBS)

  WB result of HEATR3 antibody (27335-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HEATR3 transfected HEK-293 cells. This data was developed using the same antibody clone with 27335-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27335-1-AP (same clone as 27335-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27335-1-AP (HEATR3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27335-1-AP (same clone as 27335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27335-1-AP (HEATR3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27335-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HEATR3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27335-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

HEAT repeat-containing protein 3, HEAT repeat containing 3

---

Product Information

27335-1-PBS targets HEATR3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26328

  Product name: Recombinant human HEATR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 501-680 aa of BC033077

  Sequence: SQPDFAKHVDFLEAISSALRALLQTMASKNISQCMTPDQLMTLCKAGIHSSNVGVRVNVVSILGITGSVLAKEDGTLETLKNIGCFLLEVTTKDPSLVVAGEALDALFDVFADGKEAERASIQIKLLSALKEFQPVFKMKIRKEGRGNYSTDQLCVLDNVKMNLRRFIAYQETVEKRLTS

• Full Name: HEAT repeat containing 3
• Calculated Molecular Weight: 680 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC033077
• Gene Symbol: HEATR3
• Gene ID (NCBI): 55027
• RRID: AB_3085947
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z4Q2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.